Immunogen
SLAMF7 (AAH27867, 1 a.a. ~ 296 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMVLLCLPLVPLLLSLFVLGLFLWFLKRERQEENNPKGRSSKYGLLHCGNTEKDGKSPLTAHDARHTKAICL
Biochem/physiol Actions
SLAMF7 (signaling lymphocytic activation molecule family member 7) retains the activity of CD8+ T cell which is lost in systemic lupus erythematosus, thereby promoting its antiviral functions. SLAMF7 is considered to be a self-ligand that has the ability to identify another SLAMF7 molecule as a ligand.
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | mouse |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 1B9, monoclonal |
| form | buffered aqueous solution |
| species reactivity | human |
| technique(s) | capture ELISA: suitable,immunofluorescence: suitable |
| isotype | IgG1κ |
| NCBI accession no. | BC027867 |
| UniProt accession no. | Q9NQ25 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... SLAMF7(57823) |
