General description
MAPRE3 (microtubule associated protein RP/EB family member 3), also called EB3, is a member of the EB (end-binding) protein family, which function as microtubule plus-end tracking proteins. This family consists of three proteins- EB1, 2 and 3 (MAPRE3). These proteins are composed of a calponin homology domain in their N-terminal, through which they track microtubule tips. They form dimers through their C-terminal coiled coil domains. MAPRE3 shows a ubiquitous expression pattern, and resides in centrosomes and mitotic spindle during mitosis.
Immunogen
Microtubule-associated protein RP/EB family member 3 recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
MAPRE3 (microtubule associated protein RP/EB family member 3) forms dimers with EB1 (end binding) protein, and plays essential role during cell division. It is responsible for focal adhesion stabilization and spreading of daughter cells during the end of mitosis. It facilitates stabilization of midbody microtubules thus, ensuring efficient cytokinesis. Hypermethylation of MAPRE3 resulting in its suppression leads to the pathogenic effects of TGF (tumor growth factor) β and RASFs (rheumatoid arthritis (RA) synovial fibroblasts). Both of these play integral part in the pathogenesis of RA. This protein is phosphorylated by vascular endothelial (VE)-cadherin, which results in inhibition of microtubule growth and assembly of adherens junctions.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST71202
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | human |
| technique(s) | immunoblotting: 0.04-0.4 μg/mL,immunohistochemistry: 1:20-1:50 |
| immunogen sequence | YDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLR |
| UniProt accession no. | Q9UPY8 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... MAPRE3(22924) |

