General description
LEF1 is a transcription factor that interacts with β-catenin and modulates cell adhesion. This transcription factor also mediates nuclear responses via the Wnt signaling pathway.
Rabbit Anti-LEF1 (AB2) antibody recognizes chicken, human, mouse, rat, canine, rabbit, bovine, zebrafish, and pig LEF1.
Immunogen
Synthetic peptide directed towards the C terminal region of human LEF1
Application
Rabbit Anti-LEF1 (AB2) antibody can be used for western blot (2μg/ml) and IHC (4-8μg/ml, using paraffin-embedded tissues) applications.
Biochem/physiol Actions
Lymphoid enhancer-binding factor-1 (LEF1) is a 48-kD nuclear protein that is expressed in pre-B and T cells. It binds to a functionally important site in the T-cell receptor-alpha enhancer and confers maximal enhancer activity. LEF1 belongs to a family of regulatory proteins that share homology with high mobility group protein-1.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | IgG fraction of antiserum |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 44 kDa |
| species reactivity | dog, horse, rat, rabbit, guinea pig, bovine, mouse, human, goat |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | immunohistochemistry: suitable,western blot: suitable |
| NCBI accession no. | NP_001124185 |
| UniProt accession no. | Q9UJU2 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... LEF1(51176) |
