Immunogen
Synthetic peptide directed towards the N terminal region of human APOBEC3B
Application
Anti-APOBEC3B antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.
Biochem/physiol Actions
APOBEC3B is a member of the cytidine deaminase gene family and encodes apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3B. Endogenous APOBEC3B is a principal nuclear protein that facilitates the DNA C-to-U editing activity in breast cancer cell-line extracts. APOBEC3B exhibits antiviral activity against human T-cell leukemia virus type 1 (HTLV-1) and is a potent inhibitor of simian immunodeficiency virus (SIV) replication.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: NQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYW
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 46 kDa |
| species reactivity | human |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | western blot: suitable |
| NCBI accession no. | NP_004891 |
| UniProt accession no. | Q9UH17 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... APOBEC3B(9582) |

