General description
Acetyl-CoA carboxylase (ACC) is a complex multifunctional enzyme system. ACC is a biotin-containing enzyme which catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the rate-limiting step in fatty acid synthesis. ACC-beta is thought to control fatty acid oxidation by means of the ability of malonyl-CoA to inhibit carnitine-palmitoyl-CoA transferase I, the rate-limiting step in fatty acid uptake and oxidation by mitochondria. ACC-beta may be involved in the regulation of fatty acid oxidation, rather than fatty acid biosynthesis. There is evidence for the presence of two ACC-beta isoforms. (provided by RefSeq)
Immunogen
ACACB (NP_001084, 22 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IWGKMTDSKPITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGT
Physical form
Clear solution
| biological source | mouse |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | ascites fluid |
| antibody product type | primary antibodies |
| clone | 1C11, monoclonal |
| mol wt | antigen ~37 kDa |
| species reactivity | human |
| technique(s) | indirect ELISA: suitable,western blot: 1:500-1:1000 |
| isotype | IgMκ |
| NCBI accession no. | NM_001093 |
| UniProt accession no. | O00763 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... ACACB(32) |
