General description
Mouse monoclonal antibody raised against a partial recombinant TNRC6C.
TNRC6C (Trinucleotide repeat containing 6C) is a member of GW182 (Gly-Trp) family consisting of a domain similar to Drosophila GW182 (also known as Gawky), a domain rich in GW or WG repeats followed by a glutamine (Q)-rich region at the N-proximal end, a central ubiquitin-associated (UBA) domain and an RNA-binding domain termed as RRM.
Immunogen
TNRC6C (NP_061869, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TDGPNNTNPMNSSPNPINAMQTNGLPNWGMAVGMGAIIPPHLQGLPGANGSSVSQVSGGSAEGISNSVWGLSPGNPATGNSNSGFSQGNGDTVNSALSAK
Application
Monoclonal Anti-TNRC6C antibody produced mouse is suitable for indirect ELISA.
Biochem/physiol Actions
TNRC6C (Trinucleotide repeat containing 6C) plays an important role in the microRNA repression during protein synthesis via miRNA pathway. The C-terminal RRM RNA-binding domain mediates the process of translational repression. Its GW-rich and Q-rich domain also suppress the expression for protein synthesis by binding to a reporter mRNA. In addition to translational repression, the members of the GW182 family, also participate in the deadenylation and decay of miRNA by interacting with argonaute proteins.
Physical form
Solution in phosphate buffered saline, pH 7.4
| biological source | mouse |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 3G11, monoclonal |
| form | buffered aqueous solution |
| mol wt | antigen ~36.89 kDa |
| species reactivity | human |
| technique(s) | immunofluorescence: suitable,indirect ELISA: suitable |
| isotype | IgG2aκ |
| NCBI accession no. | NM_018996 |
| UniProt accession no. | Q9HCJ0 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... TNRC6C(57690) |
