General description
Collectin 11 (COLEC11) is member of C-type lectin family of proteins. The members of this family have collagen-like sequence and a calcium dependent carbohydrate recognition domain. They are predominantly expressed in kidney cells. These proteins also interact with extracellular DNA associated with apoptotic cells and biofilms. Collectin 11 is located on human chromosome 2p25.3 and shows two splice variants, resulting in two protein isoforms.
Immunogen
collectin sub-family member 11 recombinant protein epitope signature tag (PrEST)
Application
Anti-COLEC11 antibody produced in rabbit has been used for the detection of human collectin 11 in the ficolin-3 complex using microtiter plate assay.
Biochem/physiol Actions
Collectin 11 (COLEC11) interacts with the antigenic part of the microbes to confer immune response against infections. Genetic polymorphism at promoter level affects collectin 11 expression. An amino acid variation alters its carbohydrate binding functionality. Collectin 11 is a potential host factor for preventing urinary schistosomiasis. Its allelic variation is more susceptible to the disease as the protein binds less effectively to the sugars. COLEC11 plays a key role in phagocytosis and cytokine production. Its level increases in disseminated intravascular coagulation. Mutation in COLLEC11 results in 3MC syndrome, a genetic disorder which is associated with abnormal facial features as a result of incomplete tissue development in the face and skull.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Other Notes
Corresponding Antigen APREST79013
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | human |
| technique(s) | immunohistochemistry: 1:200- 1:500 |
| immunogen sequence | INDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM |
| UniProt accession no. | Q9BWP8 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... COLEC11(78989) |

