General description
β-Synuclein (SNCB) is present in the presynaptic neuron terminal. It comprises an imperfect KTKEGV sequence at the N-terminus as well as highly acidic and intrinsically disordered regions. SNCB shares sequence similarity with α-synuclein. The SNCB gene is mapped to human chromosome 5q35.2.
Immunogen
SNCB (AAH02902, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA
Biochem/physiol Actions
β-Synuclein (SNCB) may delay the α- synuclein (αS) fibril formation and inhibit its aggregation. SNCB and αS interact with lipid vesicles to form a high degree of α-helical structure. SNCB is implicated in Dementia with Lewy bodies (DLB), a neurodegenerative dementia.
Physical form
Solution in phosphate buffered saline, pH 7.4
| biological source | mouse |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 3G6, monoclonal |
| form | buffered aqueous solution |
| mol wt | antigen ~40.85 kDa |
| species reactivity | human |
| technique(s) | capture ELISA: suitable,immunofluorescence: suitable,indirect ELISA: suitable,western blot: 1-5 μg/mL |
| isotype | IgG2aκ |
| NCBI accession no. | BC002902 |
| UniProt accession no. | Q16143 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... SNCB(6620) |
